missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDF-9 Antibody (53/1), Janelia Fluor™ 646, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-61934JF646
This item is not returnable.
View return policy
Description
GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.
Specifications
| GDF-9 | |
| Monoclonal | |
| Janelia Fluor 646 | |
| 50mM Sodium Borate with 0.05% Sodium Azide | |
| GDF9 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunohistochemistry | |
| 53/1 | |
| Western Blot, ELISA, Immunohistochemistry | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| Mouse | |
| Protein A purified | |
| Cytokine Research | |
| 2661 | |
| Store at 4°C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction