missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDF-9 Antibody (GDF9/4261), DyLight 350, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP3-08362UV
This item is not returnable.
View return policy
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry (Paraffin)
Specifications
| GDF-9 | |
| Monoclonal | |
| DyLight 350 | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383) | |
| 100 μg | |
| Cytokine Research | |
| 2661 | |
| Store at 4°C in the dark. | |
| IgG1 |
| Western Blot, ELISA, Immunohistochemistry (Paraffin) | |
| GDF9/4261 | |
| 50mM Sodium Borate | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction