missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49264-25ul
This item is not returnable.
View return policy
Description
GDI1 Polyclonal antibody specifically detects GDI1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| GDI1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| FLJ41411, GDI-1, GDIL, GDP dissociation inhibitor 1, Guanosine diphosphate dissociation inhibitor 1, mental retardation, X-linked 41, mental retardation, X-linked 48, MRX41, oligophrenin-2, OPHN2MRX48, Protein XAP-4, Rab GDI alpha, rab GDP dissociation inhibitor alpha, rab GDP-dissociation inhibitor, alpha, RABGDIARABGD1A, XAP4, XAP-4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK | |
| 25 μL | |
| Signal Transduction | |
| 2664 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction