missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GFR alpha-1/GDNF R alpha-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14045
This item is not returnable.
View return policy
Description
GFR alpha-1/GDNF R alpha-1 Polyclonal antibody specifically detects GFR alpha-1/GDNF R alpha-1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| GFR alpha-1/GDNF R alpha-1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500 | |
| DKFZp313E1012, DKFZp686J0156, GDNF family receptor alpha 1, GDNF family receptor alpha-1, GDNF receptor alpha-1, GDNFRAGFR-ALPHA-1, GDNFR-alpha-1, GDNFRMGC23045, GFR-alpha-1, Glial cell line-derived neurotrophic factor receptor alpha, GPI-linked anchor protein, PI-linked cell-surface accessory protein, RET ligand 1, RET1L, RETL1FLJ10561, TGF-beta related neurotrophic factor receptor 1, TGF-beta-related neurotrophic factor receptor 1, TRNR1FLJ31546 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK | |
| 0.1 mL | |
| Neuroscience, Signal Transduction | |
| 2674 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction