missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GGA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55191
This item is not returnable.
View return policy
Description
GGA3 Polyclonal specifically detects GGA3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| GGA3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GGA3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK | |
| 100 μL | |
| Cell Biology, Golgi Apparatus Markers | |
| 23163 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction