missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GHRH Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | GHRH |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228134
|
Novus Biologicals
NBP3-33413-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232963
|
Novus Biologicals
NBP3-33413-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GHRH Monoclonal antibody specifically detects GHRH in Human samples. It is validated for ELISA,Western BlotSpecifications
| GHRH | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, GPCR | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 2691 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| GHRFsomatocrinin, GRF, growth hormone releasing hormone, Growth hormone-releasing factor, Growth hormone-releasing hormone, INN, MGC119781, Sermorelin, Somatocrinin, somatoliberin, somatorelin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GHRH (NP_066567.1).,, Sequence:, MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title