missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GIT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35536-100ul
This item is not returnable.
View return policy
Description
GIT2 Polyclonal antibody specifically detects GIT2 in Human samples. It is validated for ELISA,Western Blot
Specifications
| GIT2 | |
| Polyclonal | |
| Western Blot 1:200 - 1:2000, ELISA | |
| ARF GAP GIT2, ARF GTPase-activating protein GIT2, CAT2, CAT-2, cool-associated, tyrosine phosphorylated protein 2, Cool-interacting tyrosine-phosphorylated protein 2, DKFZp686G01261, G protein-coupled receptor kinase interacting ArfGAP 2, G protein-coupled receptor kinase interactor 2, G protein-coupled receptor kinase-interactor 2, KIAA0148GRK-interacting protein 2, MGC760 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 450-510 of human GIT2 (NP_476511.1).,, Sequence:, ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9815 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido