missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GLE1 Polyclonal specifically detects GLE1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | GLE1 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | GLE1 (yeast homolog)-like, RNA export mediator, GLE1 RNA export mediator homolog (yeast), GLE1LGLE1 RNA export mediator-like (yeast), GLE1-like protein, GLE1-like, RNA export mediator, hGLE1GLE1 RNA export mediator (yeast), LCCS, LCCS1, lethal congenital contracture syndrome 1, nucleoporin GLE1 |
| Gene Symbols | GLE1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?