missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLMN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14056-25ul
This item is not returnable.
View return policy
Description
GLMN Polyclonal antibody specifically detects GLMN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| GLMN | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| FAP, FAP48FAP68, FKBPAP, GLMLFK506-binding protein-associated protein, glomulin, glomulin, FKBP associated protein, GVM, GVMFKBP-associated protein, VMGLOMvenous malformation with glomus cells | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LSAIGHPFPKMIFNHGRKKRTWNYLEFEEEENKQLADSMASLAYLVFVQGIHIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESV | |
| 25 μL | |
| Angiogenesis | |
| 11146 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction