missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione Peroxidase 1/GPX1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33354-100ul
This item is not returnable.
View return policy
Description
Glutathione Peroxidase 1/GPX1 Monoclonal antibody specifically detects Glutathione Peroxidase 1/GPX1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Glutathione Peroxidase 1/GPX1 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| Cellular glutathione peroxidase, EC 1.11.1, EC 1.11.1.9, glutathione peroxidase 1, GPx-1, GSHPx-1, GSHPX1, MGC14399, MGC88245 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-203 of human Glutathione Peroxidase 1/GPX1 (NP_000572.2).,, Sequence:, RPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA | |
| 100 μL | |
| Apoptosis, Cancer, Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 2876 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction