missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30517382

Glycogen phosphorylase, muscle form Antibody [PerCP], Novus Biologicals Biologicals™

Product Code. 30517382 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30517382 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30517382 Supplier Novus Biologicals Supplier No. NBP338607PCP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Glycogen phosphorylase, muscle form Polyclonal antibody specifically detects Glycogen phosphorylase, muscle form in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glycogen phosphorylase, muscle form
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate PerCP
Formulation PBS
Gene Alias EC 2.4.1.1, glycogen phosphorylase, muscle form, myophosphorylase, phosphorylase, glycogen, muscle, phosphorylase, glycogen; muscle
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human Glycogen phosphorylase, muscle form (NP_005600.1).,, Sequence:, GMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5837
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.