missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GO Protein alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | GO Protein alpha |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18104368
|
Novus Biologicals
NBP2-38477 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626085
|
Novus Biologicals
NBP2-38477-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GO Protein alpha Polyclonal specifically detects GO Protein alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GO Protein alpha | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686O0962, G-ALPHA-o, GNAO, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O, guanine nucleotide binding protein, alpha activating polypeptide O, guanine nucleotide-binding protein G(o) subunit alpha | |
| GNAO1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P09471 | |
| 2775 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title