missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPIP137 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | GPIP137 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18211332
|
Novus Biologicals
NBP2-57388 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633547
|
Novus Biologicals
NBP2-57388-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GPIP137 Polyclonal specifically detects GPIP137 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GPIP137 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1 | |
| CAPRIN1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4076 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title