missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21379-25ul
This item is not returnable.
View return policy
Description
GRK7 Polyclonal antibody specifically detects GRK7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| GRK7 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 7, GPRK7G protein-coupled receptor kinase GRK7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSG | |
| 25 μg | |
| Protein Kinase, Vision | |
| 131890 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction