missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Growth Hormone R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69449
This item is not returnable.
View return policy
Description
Growth Hormone R Polyclonal specifically detects Growth Hormone R in Human samples. It is validated for Western Blot.
Specifications
| Growth Hormone R | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| GH receptor, GHBP, growth hormone binding protein, growth hormone receptor, serum binding protein, Somatotropin receptor | |
| Rabbit | |
| 70 kDa | |
| 100 μL | |
| Cytokine Research, Signal Transduction | |
| 2690 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P10912 | |
| GHR | |
| Synthetic peptides corresponding to GHR(growth hormone receptor) The peptide sequence was selected from the N terminal of Growth hormone receptor. Peptide sequence LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction