missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRPEL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 572.00
Specifications
| Antigen | GRPEL1 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18459800
|
Novus Biologicals
NBP1-83557-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18768053
|
Novus Biologicals
NBP1-83557 |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
GRPEL1 Polyclonal specifically detects GRPEL1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| GRPEL1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 80273 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| FLJ25609, GREPEL1, grpE protein homolog 1, mitochondrial, GrpE-like 1, mitochondrial (E. coli), GrpE-like protein cochaperone, HMGEmt-GrpE#1, Mt-GrpE#1 | |
| GRPEL1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human GRPEL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title