missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSTA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46817-25ul
This item is not returnable.
View return policy
Description
GSTA1 Polyclonal antibody specifically detects GSTA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| GSTA1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P08263 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| EC 2.5.1.18, glutathione S-alkyltransferase A1, glutathione S-aryltransferase A1, glutathione S-transferase 2, glutathione S-transferase A1, glutathione S-transferase alpha 1, glutathione S-transferase Ha subunit 1, GST class-alpha member 1, GST HA subunit 1, GST, class alpha, 1, GST2, GSTA1-1, GST-epsilon, GTH1, MGC131939, S-(hydroxyalkyl)glutathione lyase A1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD | |
| 25 μL | |
| Cellular Signaling, Epitope Tags, metabolism | |
| 2938 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction