missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTF2H4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | GTF2H4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18293395
|
Novus Biologicals
NBP2-57537 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18658356
|
Novus Biologicals
NBP2-57537-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GTF2H4 Polyclonal specifically detects GTF2H4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GTF2H4 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Nucleotide Excision Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2968 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, general transcription factor IIH subunit 4, general transcription factor IIH, polypeptide 4 (52kD subunit), general transcription factor IIH, polypeptide 4, 52kDa, TFB2, TFIIH, TFIIH basal transcription factor complex p52 subunit | |
| GTF2H4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title