missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTF3C5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | GTF3C5 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18272105
|
Novus Biologicals
NBP2-55707 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637928
|
Novus Biologicals
NBP2-55707-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| GTF3C5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD | |
| GTF3C5 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9328 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title