missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HACE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55062
This item is not returnable.
View return policy
Description
HACE1 Polyclonal specifically detects HACE1 in Human samples. It is validated for Western Blot.
Specifications
| HACE1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| E3 ubiquitin-protein ligase HACE1, EC 6.3.2, HACE, HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1, HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1, KIAA1320EC 6.3.2.- | |
| Rabbit | |
| 102 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8IYU2 | |
| HACE1 | |
| Synthetic peptides corresponding to HACE1(HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1) The peptide sequence was selected from the middle region of HACE1. Peptide sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 57531 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction