missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HCC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35596-100ul
This item is not returnable.
View return policy
Description
HCC1 Polyclonal antibody specifically detects HCC1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| HCC1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CAPER, CC1.3, coactivator of activating protein-1 and estrogen receptors, DKFZp781C0423, FLJ44170, fSAP59, functional spliceosome-associated protein 59, HCC1CAPERalpha, Hepatocellular carcinoma protein 1, RNA binding motif protein 39, RNA-binding motif protein 39, RNA-binding protein 39, RNA-binding region-containing protein 2, RNPC2, RRM) containing 2, splicing factor CC1.3, Splicing factor HCC1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-508 of human HCC1 (NP_001229528.1).,, Sequence:, ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR | |
| 100 μL | |
| Cellular Markers | |
| 9584 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction