missing translation for 'onlineSavingsMsg'
Learn More

HDAC4+5+9 Antibody, Novus Biologicals™

Product Code. p-200006716 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18695654 100 μg 100µL
18604155 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18695654 Supplier Novus Biologicals Supplier No. NBP321347100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HDAC4+5+9 Polyclonal antibody specifically detects HDAC4+5+9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen HDAC4+5+9
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias HA6116, HD4EC 3.5.1.98, HDAC-A, HDACABDMR, histone deacetylase 4, histone deacetylase A, KIAA0288AHO3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Epigenetics, Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 9759
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.