Learn More
Invitrogen™ HDGF Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579355
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A549 whole cell, human 293T whole cell, human Hela whole cell, rat C6 whole cell. IHC: mouse liver tissue, rat liver tissue, human intestinal cancer tissue, human lung cancer tissue. ICC/IF: U20S cell. Flow: A431 cell.
HDGF is a member of the hepatoma-derived growth factor family. This protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation.
Specifications
| HDGF | |
| Polyclonal | |
| Unconjugated | |
| HDGF | |
| AI118077; D3Ertd299e; DKFZp686J1764; FLJ96580; Hdgf; Hepatoma-derived growth factor; high mobility group protein 1-like 2; HMG1L2; HMG-1L2; Tdrm1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 114499, 15191, 3068 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| P51858, P51859, Q8VHK7 | |
| HDGF | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.