missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30516984

HDGFRP3 Antibody [DyLight 755], Novus Biologicals Biologicals™

Product Code. 30516984 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30516984 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30516984 Supplier Novus Biologicals Supplier No. NBP338581IR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

HDGFRP3 Polyclonal antibody specifically detects HDGFRP3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen HDGFRP3
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate DyLight 755
Formulation 50mM Sodium Borate
Gene Alias HDGF2, HDGF-2, Hepatoma-derived growth factor 2, hepatoma-derived growth factor, related protein 3, hepatoma-derived growth factor-related protein 3, HRP-3
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-203 of human HDGFRP3 (NP_057157.1).,, Sequence:, NNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 50810
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.