missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HHAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | HHAT |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18497771
|
Novus Biologicals
NBP2-14089-25ul |
25ul |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18027238
|
Novus Biologicals
NBP2-14089 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HHAT Polyclonal specifically detects HHAT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HHAT | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55733 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEW | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 2.3.1.-, FLJ10724, FLJ34867, GUP2, hedgehog acyltransferaserasp, MART-2, MART2sit, melanoma antigen recognized by T cells 2, Melanoma antigen recognized by T-cells 2, protein-cysteine N-palmitoyltransferase HHAT, SKI1ski, Skinny hedgehog protein 1, Skn | |
| HHAT | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title