missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIP1 Related Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | HIP1 Related |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18123228
|
Novus Biologicals
NBP2-38390 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603036
|
Novus Biologicals
NBP2-38390-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HIP1 Related Polyclonal specifically detects HIP1 Related in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HIP1 Related | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Biology, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ14000, HIP-12, HIP12HIP1-related protein, HIP3, huntingtin interacting protein 1 related, huntingtin interacting protein 12, Huntingtin-interacting protein 12, huntingtin-interacting protein 1-related protein, ILWEQ, KIAA0655FLJ27022, MGC47513 | |
| HIP1R | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O75146 | |
| 9026 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title