missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histamine H2R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35417-20ul
This item is not returnable.
View return policy
Description
Histamine H2R Polyclonal antibody specifically detects Histamine H2R in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Histamine H2R | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| gastric receptor 1, Gastric receptor I, H2R, HH2R, histamine H2 receptor, histamine receptor H2 | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Histamine H2R (NP_001124527.1).,, Sequence:, SFLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVMGAFIICWFPY | |
| 20 μL | |
| GPCR, Stem Cell Markers | |
| 3274 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering