missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLTF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 433.00 - € 539.00
Specifications
| Antigen | HLTF |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18455970
|
Novus Biologicals
NBP1-83256-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18233656
|
Novus Biologicals
NBP1-83256 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HLTF Polyclonal specifically detects HLTF in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HLTF | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| Q14527 | |
| 6596 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Biology, Chromatin Research, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DNA-binding protein/plasminogen activator inhibitor 1 regulator, EC 3.6.1, EC 3.6.4.-, EC 6.3.2.-, helicase-like transcription factor, HIP116ARING finger protein 80, HIP116matrix associated, actin dependent regulator of chromatin, RNF80SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 3, subfamily a, member 3, Sucrose nonfermenting protein 2-like 3, ZBU1 | |
| HLTF | |
| IgG | |
| Affinity Purified | |
| Specificity of human HLTF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title