missing translation for 'onlineSavingsMsg'
Learn More
Learn More
hnRNP K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58067
This item is not returnable.
View return policy
Description
hnRNP K Polyclonal specifically detects hnRNP K in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| hnRNP K | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| dC-stretch binding protein, FLJ41122, heterogeneous nuclear ribonucleoprotein K, hnRNP K, transformation upregulated nuclear protein, Transformation up-regulated nuclear protein, TUNPHNRPKCSBP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HNRNPK | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIG | |
| 100 μL | |
| Cancer, Core ESC Like Genes, DNA Repair, Stem Cell Markers | |
| 3190 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction