missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOGA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | HOGA1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18436921
|
Novus Biologicals
NBP2-14097-25ul |
25ul |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18076319
|
Novus Biologicals
NBP2-14097 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HOGA1 Polyclonal specifically detects HOGA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HOGA1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 112817 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 4-hydroxy-2-oxoglutarate aldolase 1, C10orf65, chromosome 10 open reading frame 65, DHDPS2, DHDPSLHP3, DHDPS-like protein, Dihydrodipicolinate synthase-like, dihydrodipicolinate synthase-like, mitochondrial, dihydrodipicolinate synthetase homolog 2, EC 4.1.3.16, FLJ37472, FLJ56960, N-acetylneuraminate pyruvate lyase 2 (putative), NPL2, Probable 2-keto-4-hydroxyglutarate aldolase, probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial, Probable KHG-aldolase, Protein 569272 | |
| HOGA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title