missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXC6 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | HOXC6 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
30229457
|
Novus Biologicals
NBP3-33439-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226588
|
Novus Biologicals
NBP3-33439-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
HOXC6 Monoclonal antibody specifically detects HOXC6 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotEspecificaciones
| HOXC6 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| CP25, HHO.C8, homeo box 3C, homeo box C6, homeo box C8 protein, homeobox C6, Homeobox protein CP25, Homeobox protein HHO.C8, Homeobox protein Hox-3C, homeobox protein Hox-C6, HOX3CHOX3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HOXC6 (NP_004494.1).,, Sequence:, MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 3223 | |
| IgG | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto