missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ HPa1 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579393
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Liver Tissue, Human Placenta Tissue, A549 whole cell.
Stem cells offer a therapeutic promise for many diseases. In the case of diabetes, stem cells offer the promise that beta cells may be generated ex vivo for the possible transplantation and cure of Type I diabetes (Couri CE, et al. ). For this to happen, stem cells will need to be isolated and expanded, they will need to be differentiated toward the beta cell lineage, and the differentiated cell progeny used for transplantation may need to be isolated from complex cell mixtures following differentiation. Appropriate markers targeting cell surface molecules on developing and mature pancreatic cells will be required for such research.
Specifications
| HPa1 | |
| Polyclonal | |
| Unconjugated | |
| HPSE | |
| Endo-glucoronidase; endoglycosidase heparanase; HEP; Heparanase; Heparanase 50 kDa subunit; Heparanase 8 kDa subunit; Heparanase-1; heparanase-like; Hpa; HPA1; HPR1; HPSE; HPSE1; HSE1 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 10855, 64537 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| Q71RP1, Q9Y251 | |
| HPSE | |
| A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE). | |
| 100 μg | |
| Primary | |
| Human, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction