missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HR23A/Rad23A TUBE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | Rad23 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18292313
|
Novus Biologicals
NBP2-55089 |
100 μL |
€ 593.00 € 560.70 / 100µL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18628947
|
Novus Biologicals
NBP2-55089-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HR23A/Rad23A TUBE1 Polyclonal specifically detects HR23A/Rad23A TUBE1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Rad23 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 5886 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| hHR23A, HR23A | |
| RAD23A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title