missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HRSP12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 433.00 - € 572.00
Specifications
| Antigen | HRSP12 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463691
|
Novus Biologicals
NBP1-82453-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18237155
|
Novus Biologicals
NBP1-82453 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HRSP12 Polyclonal specifically detects HRSP12 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HRSP12 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10247 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| EC 3.1, heat-responsive protein 12perchloric acid-soluble protein, P14.5, PSPribonuclease UK114, translational inhibitor protein p14.5,14.5 kDa translational inhibitor protein, UK114 antigen homolog, UK114translational inhibitor p14.5 | |
| HRSP12 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel