missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HS3ST3A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | HS3ST3A1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18626187
|
Novus Biologicals
NBP2-49661-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18622498
|
Novus Biologicals
NBP2-49661 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HS3ST3A1 Polyclonal antibody specifically detects HS3ST3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| HS3ST3A1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Cytoskeleton Markers, Endocrinology, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 9955 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 3-OST-3A, 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase, EC 2.8.2, EC 2.8.2.30, h3-OST-3A, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1, Heparan sulfate 3-O-sulfotransferase 3A1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, HS3ST3A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title