missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD17B4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
€ 369.00 - € 533.00
Specifications
| Antigen | HSD17B4 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18403782
|
Novus Biologicals
NBP1-85296-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18064114
|
Novus Biologicals
NBP1-85296 |
0.1 mL |
€ 533.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HSD17B4 Polyclonal specifically detects HSD17B4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HSD17B4 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3295 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, 7-alpha, D-bifunctional protein, EDH17B4, hydroxysteroid (17-beta) dehydrogenase 4, MPF-2, peroxisomal, peroxisomal multifunctional enzyme type 2,17-beta-HSD IV, peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV, short chain dehydrogenase/reductase family 8C, member 1,3-alpha | |
| HSD17B4 | |
| IgG | |
| Affinity Purified | |
| Specificity of human HSD17B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title