missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD17B8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 624.00
Specifications
| Antigen | HSD17B8 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18446410
|
Novus Biologicals
NBP1-84309-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18290008
|
Novus Biologicals
NBP1-84309 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HSD17B8 Polyclonal specifically detects HSD17B8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HSD17B8 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| D6S2245EdJ1033B10.9, EC 1.1.1.-, EC 1.1.1.62, EC 1.1.1.63,17-beta-HSD 8, estrogen 17-oxidoreductase, FABGLestradiol 17-beta-dehydrogenase 8, H2-KE6, HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli), hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase, ke-6, KE6, Ke-6,17-beta-hydroxysteroid dehydrogenase 8, Protein Ke6, Really interesting new gene 2 protein, RING2FABG, SDR30C1, short chain dehydrogenase/reductase family 30C, member 1, Testosterone 17-beta-dehydrogenase 8 | |
| HSD17B8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7923 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title