missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16376404

Invitrogen™ HSPA2 Monoclonal Antibody (4A4)
GREENER_CHOICE

Product Code. 16376404 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16376404 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16376404 Supplier Invitrogen™ Supplier No. MA533000

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MDA-MB-231 whole cell, human COLO-320 whole cell, human PANC-1 whole cellhuman HT1080 whole cell, human MDA-MB-453 whole cell, human HepG2 whole cell, rat lung tissue, rat liver tissue, rat kidney tissue, rat testicular tissue, mouse lung tissue, mouse liver tissue, mouse kidney tissue, mouse testicular tissue, mouse RAW2467 whole cell. IHC: human lung cancer tissue. ICC/IF: PC-3 cell. Flow: PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSPA2
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
Classification Monoclonal
Clone 4A4
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene HSPA2
Gene Accession No. P14659, P17156, P54652
Gene Alias 70 kDa heat shock protein; 70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; heat shock protein 2; heat shock protein 70.2; heat shock protein alpha 2; heat shock protein family A (Hsp70) member 2; heat shock protein, 70 kDa 2; heat shock-related 70 kDa protein 2; HSP; HSP70.2; HSP70.3; Hsp70-2; HSP70-3; HSP70A2; Hspa2; Hspt70; HST; Hst70; LOW QUALITY PROTEIN: heat shock-related 70 kDa protein 2; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
Gene Symbols HSPA2
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15512, 3306, 60460
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.