missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSPH1/HSP105 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55047
This item is not returnable.
View return policy
Description
HSPH1/HSP105 Polyclonal specifically detects HSPH1/HSP105 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| HSPH1/HSP105 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Antigen NY-CO-25, heat shock 105kD beta, heat shock 105kDa protein 1, heat shock 105kDa/110kDa protein 1, Heat shock 110 kDa protein, heat shock protein 105 kDa, HSP105A, HSP105B, HSP105heat shock 105kD alpha, HSP110, KIAA0201DKFZp686M05240, NY-CO-25 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10808 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HSPH1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAG | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction