missing translation for 'onlineSavingsMsg'
Learn More
Learn More
htrA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62690
This item is not returnable.
View return policy
Description
htrA4 Polyclonal antibody specifically detects htrA4 in Human samples. It is validated for Western Blot
Specifications
| htrA4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| EC 3.4.21, EC 3.4.21.-, EC 3.4.21.108, FLJ90724, HtrA serine peptidase 4, probable serine protease HTRA4 | |
| Synthetic peptides corresponding to HTRA4(HtrA serine peptidase 4) The peptide sequence was selected form the middle region of HTRA4. Peptide sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Cell Biology | |
| 203100 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| P83105 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction