missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ABCF2 (aa 545-634) Control Fragment Recombinant Protein

Product Code. 30205602
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205602

Brand: Invitrogen™ RP92614

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54517 (PA5-54517. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OCIAD1 was identified via immunoscreening of an ovarian carcinoma cDNA library from ovarian cancer patients and is expressed in multiple tissues including ovary, placenta, brain, testis, prostate, and mammary gland. Two isoforms of OCIAD1 are known to exist; the shorter isoform is restricted to the central nervous system. OCIAD1 is a transmembrane protein whose overexpression in HEY ovarian cancer cells increased lysophosphatidic acid- (LPA-)induced, but not basal level cell adhesion to extracellular matrix proteins collagen I and laminin10/11. This adhesion is not blocked by LY294002 and GF109203X, suggesting that OCIAD1 does not use protein kinase C and PI3 kinase signaling pathways to exert its effect on adhesion.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UG63
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10061
Name Human ABCF2 (aa 545-634) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710005O05Rik; ABC28; Abcf2; ABC-type transport protein; ATP binding cassette subfamily F member 2; ATP-binding cassette sub-family F member 2; ATP-binding cassette, subfamily F (GCN20), member 2; ATP-binding cassette, sub-family F (GCN20), member 2; developmentally regulated repeat element-containing transcript 3; DKFZp586K1823; Drr3; E430001O06; EST133090; HUSSY18; HUSSY-18; Iron-inhibited ABC transporter 2; M-ABC1
Common Name ABCF2
Gene Symbol Abcf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.