missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202076

Invitrogen™ Human Acetyl-CoA Carboxylase (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30202076
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202076

Brand: Invitrogen™ RP103485

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-83343 (PA5-83343, PA5-84580 (PA5-84580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13085
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 31
Name Human Acetyl-CoA Carboxylase (aa 1-62) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A1Z784_DROME; A530025K05Rik; Acac; Acaca; ACACAD; Acc; ACC1; ACCA; ACC-alpha; ACC-PA; ACC-PB; ACC-PC; ACC-PE; ACC-PF; ACC-PG; aceto-acetyl-CoA-thiolase; acetyl CoA carboxylase; acetyl coenzyme A carboxylase; Acetyl-CoA carboxylase; Acetyl-CoA carboxylase 1; acetyl-CoA carboxylase 265; acetyl-CoA carboxylase alpha; acetyl-CoA-carboxylase; acetyl-coenzyme A carboxylase; acetyl-coenzyme A carboxylase alpha; ACoT; Biotin carboxylase; CG11198; CG11198-PA; CG11198-PB; CG11198-PC; CG11198-PE; CG11198-PF; CG11198-PG; CG8723; dACC; DmACC; Dmel\CG11198; Dmel_CG11198; EC 6.3.4.14; EC 6.4.1.2; FBgn0043811; GH12002p; Gm738; I79_006999; unnamed protein product
Common Name Acetyl-CoA Carboxylase
Gene Symbol Acaca
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.