missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAMTS5 (aa 854-930) Control Fragment Recombinant Protein

Product Code. 30203264
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203264

Brand: Invitrogen™ RP105844

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS5, also known as Implantin or Aggrecanase 2, is a member of the larger family of ADAMs (A Disintegrin And Metalloproteinase) metalloproteinases containing thrombospondin (TS) repeats. ADAMTS5 (A Disintegrin And Metalloproteinase with Thrombospondin-5 motif) was first described as ADAMTS5, a protein elevated in mice during the peri-implantion period. At the same time, another group identified Aggrecanase 11, a protein elevated in arthritic synovium. The name was later changed to ADAMTS5. ADAMTS5 is expressed in human and mouse. It has been found in heart, lung, cervix, uterus, ovary, brain, cartilage, and numerous other tissues, as well as chondroblastoma cell lines.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UNA0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11096
Name Human ADAMTS5 (aa 854-930) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530092O11Rik; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 11; A disintegrin and metalloproteinase with thrombospondin motifs 5; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 5; ADAM metallopeptidase with thrombospondin type 1 motif, 5; ADAMs; ADAM-TS 11; ADAM-TS 5; ADAMTS family member; ADAMTS1; ADAMTS11; ADAMTS-11; ADAMTS5; ADAM-TS5; ADAMTS-5; ADMP2; ADMP-2; Aggrecanase 2; Aggrecanase-2; AI481094; ASMP-2; Implantin; metalloendopeptidases
Common Name ADAMTS5
Gene Symbol ADAMTS5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.