missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADH5 (aa 263-320) Control Fragment Recombinant Protein

Product Code. 30209806
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209806

Brand: Invitrogen™ RP96756

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60761 (PA5-60761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11766
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 128
Name Human ADH5 (aa 263-320) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ADH1C; Adh2; Adh-2; ADH3; ADH-3; ADH5; Adh-5; ADH-B2; ADHX; alcohol dehydrogenase (class III), chi polypeptide; alcohol dehydrogenase 1 C (class I), gamma polypeptide; alcohol dehydrogenase 2; Alcohol dehydrogenase 5; alcohol dehydrogenase 5 (class III), chi polypeptide; alcohol dehydrogenase B2; Alcohol dehydrogenase class chi chain; alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; class III alcohol dehydrogenase; class III alcohol dehydrogenase, chi subunit; epididymis secretory sperm binding protein Li 60 p; FALDH; FDH; formaldehyde dehydrogenase; glutathione-dependent formaldehyde dehydrogenase; GSH-FDH; GSNOR; HEL-S-60 p; S-(hydroxymethyl)glutathione dehydrogenase; S-nitrosoglutathione reductase
Common Name ADH5
Gene Symbol ADH5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.