missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16161370

Abnova™ Human AKR1B1 (NP_001619, 1 a.a. - 316 a.a.) Full-length Recombinant Protein

Product Code. 16161370
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16161370 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16161370 Supplier Abnova™ Supplier No. P3474.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for Func, SDS-PAGE

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq]

Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Specifications

Accession Number NP_001619
Concentration 1 mg/mL
For Use With (Application) Functional Study, SDS-PAGE
Formulation In 20mM Tris-HCl, pH 8.0 (1mM dithiothreitol, 10% glycerol)
Gene ID (Entrez) 231
Molecular Weight (g/mol) 35.8kDa
Name AKR1B1 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 100 μg
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <1.0 EU/μg of protein (determined by LAL method)
Gene Alias ADR/ALDR1/ALR2/AR/MGC1804
Common Name AKR1B1
Gene Symbol AKR1B1
Biological Activity Specific activity: approximately 0.5-0.6 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1μmole NADPH/min at 25°C. Specific activity was expressed as units/mg protein.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.