missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200281

Invitrogen™ Human Alix (aa 140-267) Control Fragment Recombinant Protein

Product Code. 30200281
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200281

Brand: Invitrogen™ RP108885

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptotic linked-gene-product 2 (ALG-2) interacting protein X (ALIX) is a conserved adaptor protein which is ubiquitously expressed. Alix was originally reported to play a role in apoptosis but has recently been shown to be involved in other cellular mechanisms including endosomal sorting, endocytosis, viral budding and actin cytoskeleton assembly.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WUM4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10015
Name Human Alix (aa 140-267) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI480591; AIP1; ALG-2 interacting protein 1; ALG-2 interacting protein X; ALG-2-interacting protein 1; Alg2-interacting protein 1; ALG-2-interacting protein X; Alg2-interacting protein X; Alix; apoptosis-linked gene 2-interacting protein X; AW544830; C76364; dopamine receptor interacting protein 4; DRIP4; E2F1-inducible protein; Eig2; Hp95; KIAA1375; MGC17003; mKIAA1375; PDCD6-interacting protein; Pdcd6ip; pdcd6ip.L; programmed cell death 6 interacting protein; programmed cell death 6 interacting protein L homeolog; programmed cell death 6-interacting protein; putative signal tranduction protein Xp95; RGD1561176; Signal transduction protein Xp95; XELAEV_18031317mg; xp95
Common Name Alix
Gene Symbol Pdcd6ip
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.