missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181245

Invitrogen™ Human AP4S1 (aa 91-156) Control Fragment Recombinant Protein

Product Code. 30181245
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181245

Brand: Invitrogen™ RP98361

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59011 (PA5-59011. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adaptor complexes small subunit protein family. These proteins are components of the heterotetrameric adaptor protein complexes, which play important roles in the secretory and endocytic pathways by mediating vesicle formation and sorting of integral membrane proteins. The encoded protein is the small subunit of adaptor protein complex-4, which is associated with both clathrin- and nonclathrin-coated vesicles. Mutations in this gene are associated with spastic quadriplegic cerebral palsy-6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y587
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11154
Name Human AP4S1 (aa 91-156) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adapter-related protein complex 4 subunit sigma-1; adaptor related protein complex 4 sigma 1 subunit; adaptor related protein complex 4 subunit sigma 1; adaptor related protein complex 4, sigma 1 subunit; adaptor-related protein complex 4 subunit sigma-1; adaptor-related protein complex 4, sigma 1 subunit; adaptor-related protein complex AP-4, sigma 1; AI314282; AP4; AP-4 adapter complex subunit sigma-1; AP-4 adaptor complex subunit sigma-1; AP-4 complex subunit sigma-1; AP47B; Ap4s1; ap4s1 protein; CLA20; CLAPS4; clathrin-associated/assembly/adaptor protein, sigma 4; CPSQ6; LOC618267 protein; si:dz115o7.1; si:dz234g15.5; sigma-1 subunit of AP-4; Sigma-4-adaptin; sigma4-adaptin; SPG52; zgc:136677
Common Name AP4S1
Gene Symbol AP4S1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.