missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human APE1 (aa 103-251) Control Fragment Recombinant Protein

Product Code. 30194801
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194801

Brand: Invitrogen™ RP88935

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian apurinic/apyrimidinic endonuclease (APE/ref-1) is a multifunctional, bipartite enzyme that plays an important role in numerous, cellular functions. APE is responsible for repairing abasic sites in DNA and in regulating the redox state of other proteins that play roles in oxidative signaling, transcription factor regulation (Fos, Jun, NF-kB, Myb, HIF-1 alpha, CREB, Pax), cell cycle control (p53), and apoptosis. The most common form of DNA damage is the creation of abasic sites which are brought about through spontaneous loss or oxidative DNA damage, through chemically initiated hydrolysis (chemotherapy), ionizing radiation, UV irradiation, oxidizing agents, and removal of modified bases by DNA glycosylases. APE is differentially expressed during development and in different tissues. This protein has diverse subcellular localization patterns which support the possibility of its interaction with numerous, other cellular proteins in addition to DNA repair within the nucleus. Regulation of APE by phosphorylation is mediated, at least in part, by casein kinase II. Increases in APE message and protein levels are observed upon the reintroduction of oxygen to hypoxic cells, and in some malignant tissue relative to normal tissue. Decreases in APE expression have been associated with the induction of cellular apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P27695
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 328
Name Human APE1 (aa 103-251) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AP endonuclease 1; AP endonuclease class I; AP lyase; Ape; APE1; APEN; Apex; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX nuclease 1; Apex1; apurinic/a; Apurinic/apy; apurinic/apyrimidinic (abasic) endonuclease; apurinic/apyrimidinic endodeoxyribonuclease 1; apurinic/apyrimidinic endonuclease; apurinic/apyrimidinic endonuclease 1; Apurinic-apyrimidinic endonuclease 1; APX; BAP 1; BAP1; deoxyribonuclease (apurinic or apyrimidinic); DNA-(apurinic or apyrimidinic site) endonuclease; DNA-(apurinic or apyrimidinic site) lyase; DNA-(apurinic or apyrimidinic site) lyase, mitochondrial; HAP1; protein REF-1; redox factor 1; redox factor-1; REF1; REF-1
Common Name APE1
Gene Symbol APEX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.