missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203039

Invitrogen™ Human APOE (aa 234-294) Control Fragment Recombinant Protein

Product Code. 30203039
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203039

Brand: Invitrogen™ RP103988

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apo E (Apolipoprotein E) plays an important role in the metabolism of lipids in the plasma, and is also is a constituent of various plasma lipoprotein-lipid particles. The protein is synthesized in liver, brain, spleen, and the kidney, and concentrations are high in interstitial fluids, where it plays a role in distributing cholesterol from cells where cholesterol is in excess to cells which require cholesterol. Apo E also plays an important role in the formation of very low density lipoprotein and chylomicrons. The Apo E gene is located on chromosome 19 at position 19q13. 2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P02649
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 348
Name Human APOE (aa 234-294) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AD2; AI255918; APOE; apo-E; ApoE4; APOEA; Apolipoprotein; apolipoprotein E; apolipoprotein E3; apolipoprotein E4; Apoprotein; B2G1; BG; LDLCQ5; LPG; MGC1571
Common Name APOE
Gene Symbol APOE
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.