missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Apolipoprotein B (aa 591-689) Control Fragment Recombinant Protein

Product Code. 30196083
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196083

Brand: Invitrogen™ RP103054

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111298 (PA5-111298. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apolipoprotein B (apo B) in human plasma is a major protein of low density lipoproteins (LDL) with a molecular mass of approximately 260-500 kDa. Apolipoprotein B binds to specific receptors on cell membranes and is involved in removal of LDL and very low density lipoprotein (VLDL) cholesterol from circulation. Low-density lipoprotein (LDL) is the carrier protein for cholesterol in the blood. LDL binds to its receptor on the capillary walls and thereby mediates the uptake and clearance of cholesterol from the circulation. In atherosclerotic lesions oxidatively modified LDL is found and oxidized LDL is specifically recognized and ingested by macrophages via scavenger receptor A and CD36. Oxidized LDL may be a marker of atherosclerosis but the precise changes in oxidized LDL are not well described. MDA-oxidized LDL appear to be different from LDL oxidized by other means. Apolipoprotein B is mostly synthesized in the liver, and is a major apolipoprotein of very low density, intermediate density and low density lipoproteins (LDL) as well as being a major component of lipoprotein (a). Apolipoprotein B is a ligand for the LDL receptor and elevated levels are associated with premature atherosclerosis. Normal plasma apolipoprotein B levels are around 800mg/L. Apolipoprotein B occurs in plasma as two main isoforms, apoB-48 and apoB-100. The intestinal and the hepatic forms of Apolipoprotein B are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA-UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in the Apolipoprotein B gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective Apolipoprotein B, diseases affecting plasma cholesterol and Apolipoprotein B levels.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P04114
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 338
Name Human Apolipoprotein B (aa 591-689) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Aa1064; Ac1-060; AI315052; Apo B100; Apo B-100; Apo B-48; APOB; apo-B; ApoB 100; ApoB 48; ApoB-100; apob-48; apolipo b; apolipoprotein B; apolipoprotein B (including Ag(x) antigen); Apolipoprotein B 100; Apolipoprotein B 48; apolipoprotein B PI; Apolipoprotein B100; apolipoprotein B-100; apolipoprotein B46; apolipoprotein B47; apolipoprotein B48; Apolipoprotein B-48; apolipoprotein B49; FLDB; LDLCQ4; LOX-1; mCG_129875; MGC176318; Ox-LDL receptor 1
Common Name Apolipoprotein B
Gene Symbol APOB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.